PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000375685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 392aa    MW: 43361.4 Da    PI: 7.5425
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000375685genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.3e-141474148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHT............TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmg............kgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ +++++G+g +W + ++++g            ++R++k+c++rw++yl
    MDP0000375685 14 KGPWSPEEDATLKAYIEKHGTGgNWIALPQKIGqexitsnsphpsLRRCGKSCRLRWLNYL 74
                     79*********************************************************97 PP

2Myb_DNA-binding34.93.6e-1181123246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++       G++ W+ Ia  ++ gRt++++k++w++
    MDP0000375685  81 GGFSEEEDNIICSFYMSIGSR-WSIIAGQLP-GRTDNDIKNYWNT 123
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.999974IPR017930Myb domain
SuperFamilySSF466894.69E-2411121IPR009057Homeodomain-like
SMARTSM007172.0E-111376IPR001005SANT/Myb domain
PfamPF002492.1E-131474IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-231581IPR009057Homeodomain-like
CDDcd001675.63E-81674No hitNo description
PROSITE profilePS5129419.99175129IPR017930Myb domain
SMARTSM007175.3E-1079127IPR001005SANT/Myb domain
PfamPF002497.7E-1081123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2282129IPR009057Homeodomain-like
CDDcd001672.65E-783125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDATLKAYIE KHGTGGNWIA LPQKIGQEXI TSNSPHPSLR  60
RCGKSCRLRW LNYLRPNIKH GGFSEEEDNI ICSFYMSIGS RWSIIAGQLP GRTDNDIKNY  120
WNTRLKKKLL GRQRKQQQVQ QSRRTASFKQ GMIKRSENIA NFINIPAGFD NQNPYDLPEL  180
PVVPVXNYQT HNPQLIKDQA SIKNMLINLG GRFSHDSDTN NTSFQYPIDI LSTSSSDQQF  240
YQSSINVLSC TSAANNNNYS QFPGTHCDAS NGTGGSSSPT MFHGXNDQNN NLQVDHLHPL  300
SELEIYDNNF AHQHQQLGGF YYQATTETLN NGSTAGTSTA SAESEISWGD INSLVYSTQM  360
VAGYETSCPQ AVTVPPGLPT VFAESTLLGL K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23141297108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368215.10.0PREDICTED: transcription factor RAX3-like
TrEMBLM5WKM30.0M5WKM3_PRUPE; Uncharacterized protein
STRINGVIT_00s1352g00010.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-71myb domain protein 84